PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30024.m001687
Common NameRCOM_1241280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family Nin-like
Protein Properties Length: 293aa    MW: 33398.2 Da    PI: 5.3533
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30024.m001687genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK78.38.7e-25186233552
         RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    +++e+++k+F+ pi++AAke++v+lTvLK++CR++ I+RWPhRki+sl
  30024.m001687 186 LEFEEIQKHFDVPITKAAKEMKVGLTVLKKRCRELKIMRWPHRKIRSL 233
                    89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.404172254IPR003035RWP-RK domain
PfamPF020422.5E-22186233IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MDSKATGQPL MNIANKENPF DIDWSCTEME ETFQIMSELP PIQSCIEMDS LALPWEKDDY  60
GFEGFEELDI DCSILDNSLV SWDEDSMIDR KPIVNSLKIE SGAVPHKALA QSHDCASNSS  120
MNKEENTVVD RNPAVNSSVI NVKIESSEVS DMILAQSQDC ASNSSMEREE EKRIPNGGRK  180
RASVPLEFEE IQKHFDVPIT KAAKEMKVGL TVLKKRCREL KIMRWPHRKI RSLESLINNV  240
KEMGLTKEIV MLEEHRKLVE KVPGMELTER TKRLRQACFK ANYKKKRCLA GYA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002516651.20.0PREDICTED: protein RKD4
TrEMBLB9RSD20.0B9RSD2_RICCO; Transcription factor, putative
STRINGPOPTR_0012s02390.11e-65(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.12e-42RWP-RK domain-containing protein